Placeholder image of a protein
Icon representing a puzzle

2086: Revisiting Puzzle 95: Chicken

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Australia 11. Australia 2 pts. 10,084
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,074
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,757
  4. Avatar for Russian team 14. Russian team 1 pt. 9,747
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,615
  6. Avatar for Team China 16. Team China 1 pt. 9,522
  7. Avatar for Team Canada 17. Team Canada 1 pt. 8,962
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 8,857
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 7,241
  1. Avatar for heather-1 41. heather-1 Lv 1 26 pts. 10,173
  2. Avatar for kevin everington 42. kevin everington Lv 1 25 pts. 10,172
  3. Avatar for hansvandenhof 43. hansvandenhof Lv 1 24 pts. 10,168
  4. Avatar for ProfVince 44. ProfVince Lv 1 24 pts. 10,157
  5. Avatar for NeLikomSheet 45. NeLikomSheet Lv 1 23 pts. 10,141
  6. Avatar for ucad 46. ucad Lv 1 22 pts. 10,123
  7. Avatar for WBarme1234 47. WBarme1234 Lv 1 21 pts. 10,100
  8. Avatar for AlkiP0Ps 48. AlkiP0Ps Lv 1 20 pts. 10,084
  9. Avatar for vybi 49. vybi Lv 1 19 pts. 10,074
  10. Avatar for alcor29 50. alcor29 Lv 1 19 pts. 10,065

Comments