Placeholder image of a protein
Icon representing a puzzle

2086: Revisiting Puzzle 95: Chicken

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Australia 11. Australia 2 pts. 10,084
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,074
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,757
  4. Avatar for Russian team 14. Russian team 1 pt. 9,747
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,615
  6. Avatar for Team China 16. Team China 1 pt. 9,522
  7. Avatar for Team Canada 17. Team Canada 1 pt. 8,962
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 8,857
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 7,241
  1. Avatar for equilibria 61. equilibria Lv 1 12 pts. 9,906
  2. Avatar for carxo 62. carxo Lv 1 11 pts. 9,900
  3. Avatar for drumpeter18yrs9yrs 63. drumpeter18yrs9yrs Lv 1 11 pts. 9,879
  4. Avatar for Oransche 64. Oransche Lv 1 10 pts. 9,874
  5. Avatar for DScott 65. DScott Lv 1 10 pts. 9,872
  6. Avatar for chrisb41 66. chrisb41 Lv 1 9 pts. 9,841
  7. Avatar for Wiz kid 67. Wiz kid Lv 1 9 pts. 9,828
  8. Avatar for cjddig 68. cjddig Lv 1 9 pts. 9,807
  9. Avatar for Trajan464 69. Trajan464 Lv 1 8 pts. 9,797
  10. Avatar for Anfinsen_slept_here 70. Anfinsen_slept_here Lv 1 8 pts. 9,787

Comments