Placeholder image of a protein
Icon representing a puzzle

2086: Revisiting Puzzle 95: Chicken

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Australia 11. Australia 2 pts. 10,084
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,074
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,757
  4. Avatar for Russian team 14. Russian team 1 pt. 9,747
  5. Avatar for Void Crushers 15. Void Crushers 1 pt. 9,615
  6. Avatar for Team China 16. Team China 1 pt. 9,522
  7. Avatar for Team Canada 17. Team Canada 1 pt. 8,962
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 8,857
  9. Avatar for Foldit Staff 19. Foldit Staff 1 pt. 7,241

  1. Avatar for latin krepin 81. latin krepin Lv 1 5 pts. 9,611
  2. Avatar for Hellcat6 82. Hellcat6 Lv 1 4 pts. 9,607
  3. Avatar for tracybutt 83. tracybutt Lv 1 4 pts. 9,607
  4. Avatar for ARLUC 84. ARLUC Lv 1 4 pts. 9,599
  5. Avatar for rinze 85. rinze Lv 1 4 pts. 9,586
  6. Avatar for dymytril 86. dymytril Lv 1 4 pts. 9,574
  7. Avatar for kentish_alex 87. kentish_alex Lv 1 3 pts. 9,557
  8. Avatar for REDing 88. REDing Lv 1 3 pts. 9,522
  9. Avatar for rezaefar 89. rezaefar Lv 1 3 pts. 9,487
  10. Avatar for kaylut 90. kaylut Lv 1 3 pts. 9,486

Comments