Placeholder image of a protein
Icon representing a puzzle

2086: Revisiting Puzzle 95: Chicken

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,746
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 10,725
  3. Avatar for Go Science 3. Go Science 56 pts. 10,703
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,694
  5. Avatar for Contenders 5. Contenders 29 pts. 10,628
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 10,509
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,485
  8. Avatar for AlphaFold 8. AlphaFold 9 pts. 10,413
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 10,360
  10. Avatar for foldeRNA 10. foldeRNA 4 pts. 10,301
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 1 pt. 10,592
  2. Avatar for jeff101 12. jeff101 Lv 1 1 pt. 10,587
  3. Avatar for maithra 13. maithra Lv 1 1 pt. 10,573
  4. Avatar for BootsMcGraw 14. BootsMcGraw Lv 1 1 pt. 10,564
  5. Avatar for georg137 15. georg137 Lv 1 1 pt. 10,552
  6. Avatar for phi16 16. phi16 Lv 1 1 pt. 10,505
  7. Avatar for jamiexq 17. jamiexq Lv 1 1 pt. 10,494

Comments