Placeholder image of a protein
Icon representing a puzzle

2086: Revisiting Puzzle 95: Chicken

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,746
  2. Avatar for Marvin's bunch 2. Marvin's bunch 76 pts. 10,725
  3. Avatar for Go Science 3. Go Science 56 pts. 10,703
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,694
  5. Avatar for Contenders 5. Contenders 29 pts. 10,628
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 10,509
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,485
  8. Avatar for AlphaFold 8. AlphaFold 9 pts. 10,413
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 6 pts. 10,360
  10. Avatar for foldeRNA 10. foldeRNA 4 pts. 10,301
  1. Avatar for Shortbread 71. Shortbread Lv 1 7 pts. 9,781
  2. Avatar for dahast.de 72. dahast.de Lv 1 7 pts. 9,757
  3. Avatar for Gerom 73. Gerom Lv 1 7 pts. 9,747
  4. Avatar for zannipietro 74. zannipietro Lv 1 6 pts. 9,731
  5. Avatar for kyoota 75. kyoota Lv 1 6 pts. 9,712
  6. Avatar for Dr.Sillem 76. Dr.Sillem Lv 1 6 pts. 9,684
  7. Avatar for matt61ger 77. matt61ger Lv 1 6 pts. 9,664
  8. Avatar for pfirth 78. pfirth Lv 1 5 pts. 9,636
  9. Avatar for RWoodcock 79. RWoodcock Lv 1 5 pts. 9,616
  10. Avatar for Simek 80. Simek Lv 1 5 pts. 9,615

Comments