Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Australia 11. Australia 2 pts. 9,171
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 8,967
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 8,883
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 8,777
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,374
  6. Avatar for Protein structural analysis room Japan 16. Protein structural analysis room Japan 1 pt. 8,186
  7. Avatar for Wright Biology SBI4U 17. Wright Biology SBI4U 1 pt. 5,857
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 3,129
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,284
  2. Avatar for frood66 2. frood66 Lv 1 97 pts. 10,162
  3. Avatar for Aubade01 3. Aubade01 Lv 1 94 pts. 10,142
  4. Avatar for Keresto 4. Keresto Lv 1 91 pts. 10,132
  5. Avatar for Idiotboy 5. Idiotboy Lv 1 88 pts. 10,098
  6. Avatar for Arthuriel 6. Arthuriel Lv 1 85 pts. 10,089
  7. Avatar for manu8170 7. manu8170 Lv 1 82 pts. 10,065
  8. Avatar for dcrwheeler 8. dcrwheeler Lv 1 80 pts. 10,064
  9. Avatar for Galaxie 9. Galaxie Lv 1 77 pts. 10,052
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 75 pts. 10,037

Comments