Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since over 4 years ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,285
  2. Avatar for Marvin's bunch 2. Marvin's bunch 74 pts. 10,162
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,132
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,120
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,052
  6. Avatar for Go Science 6. Go Science 18 pts. 10,037
  7. Avatar for Contenders 7. Contenders 12 pts. 9,946
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 9,689
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,273
  10. Avatar for Russian team 10. Russian team 3 pts. 9,241

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,284
  2. Avatar for frood66 2. frood66 Lv 1 97 pts. 10,162
  3. Avatar for Aubade01 3. Aubade01 Lv 1 94 pts. 10,142
  4. Avatar for Keresto 4. Keresto Lv 1 91 pts. 10,132
  5. Avatar for Idiotboy 5. Idiotboy Lv 1 88 pts. 10,098
  6. Avatar for Arthuriel 6. Arthuriel Lv 1 85 pts. 10,089
  7. Avatar for manu8170 7. manu8170 Lv 1 82 pts. 10,065
  8. Avatar for dcrwheeler 8. dcrwheeler Lv 1 80 pts. 10,064
  9. Avatar for Galaxie 9. Galaxie Lv 1 77 pts. 10,052
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 75 pts. 10,037

Comments