Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since over 4 years ago

Novice Overall Prediction

Summary


Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,285
  2. Avatar for Marvin's bunch 2. Marvin's bunch 74 pts. 10,162
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,132
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,120
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,052
  6. Avatar for Go Science 6. Go Science 18 pts. 10,037
  7. Avatar for Contenders 7. Contenders 12 pts. 9,946
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 9,689
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,273
  10. Avatar for Russian team 10. Russian team 3 pts. 9,241

  1. Avatar for gmn 21. gmn Lv 1 50 pts. 9,892
  2. Avatar for jobo0502 22. jobo0502 Lv 1 49 pts. 9,890
  3. Avatar for Skippysk8s 23. Skippysk8s Lv 1 47 pts. 9,885
  4. Avatar for NeLikomSheet 24. NeLikomSheet Lv 1 45 pts. 9,885
  5. Avatar for georg137 25. georg137 Lv 1 43 pts. 9,862
  6. Avatar for BootsMcGraw 26. BootsMcGraw Lv 1 42 pts. 9,849
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 40 pts. 9,837
  8. Avatar for jausmh 28. jausmh Lv 1 39 pts. 9,804
  9. Avatar for Lotus23 29. Lotus23 Lv 1 37 pts. 9,765
  10. Avatar for Vinara 30. Vinara Lv 1 36 pts. 9,721

Comments