Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,638
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,458
  3. Avatar for BC125_Buco,Palisoc,Torre 13. BC125_Buco,Palisoc,Torre 1 pt. 9,270
  4. Avatar for Team China 14. Team China 1 pt. 8,874
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,799
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,730
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,639
  8. Avatar for pikem125 18. pikem125 1 pt. 8,613
  1. Avatar for Bless Verganio 91. Bless Verganio Lv 1 2 pts. 9,202
  2. Avatar for cjddig 92. cjddig Lv 1 2 pts. 9,179
  3. Avatar for rinze 93. rinze Lv 1 2 pts. 9,164
  4. Avatar for Eumene 94. Eumene Lv 1 2 pts. 9,158
  5. Avatar for drumpeter18yrs9yrs 95. drumpeter18yrs9yrs Lv 1 2 pts. 9,141
  6. Avatar for IchBinBea 96. IchBinBea Lv 1 2 pts. 9,097
  7. Avatar for vincentvanghost 97. vincentvanghost Lv 1 2 pts. 9,094
  8. Avatar for Origami314_IRC 98. Origami314_IRC Lv 1 2 pts. 9,075
  9. Avatar for LELE1964 99. LELE1964 Lv 1 2 pts. 9,026
  10. Avatar for alexrg2002 100. alexrg2002 Lv 1 1 pt. 9,023

Comments