Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,199
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 11,186
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 11,123
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 11,096
  5. Avatar for Contenders 5. Contenders 27 pts. 10,758
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,744
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,683
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 10,681
  9. Avatar for Australia 9. Australia 5 pts. 10,236
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,690
  1. Avatar for NinjaGreg
    1. NinjaGreg Lv 1
    100 pts. 11,188
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 11,186
  3. Avatar for grogar7 3. grogar7 Lv 1 95 pts. 11,123
  4. Avatar for frood66 4. frood66 Lv 1 92 pts. 11,096
  5. Avatar for Idiotboy 5. Idiotboy Lv 1 89 pts. 10,854
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 86 pts. 10,854
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 83 pts. 10,806
  8. Avatar for Deleted player 8. Deleted player pts. 10,804
  9. Avatar for Arthuriel 9. Arthuriel Lv 1 78 pts. 10,777
  10. Avatar for g_b 10. g_b Lv 1 76 pts. 10,764

Comments