Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,638
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,458
  3. Avatar for Team China 14. Team China 1 pt. 8,874
  4. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,799
  5. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,730
  6. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,639
  7. Avatar for pikem125 18. pikem125 1 pt. 8,613

  1. Avatar for liorz1984 101. liorz1984 Lv 1 1 pt. 8,971
  2. Avatar for cherry39 102. cherry39 Lv 1 1 pt. 8,934
  3. Avatar for kludbrook 103. kludbrook Lv 1 1 pt. 8,932
  4. Avatar for JustinRothganger 104. JustinRothganger Lv 1 1 pt. 8,875
  5. Avatar for zo3xiaJonWeinberg 105. zo3xiaJonWeinberg Lv 1 1 pt. 8,874
  6. Avatar for amtabello 106. amtabello Lv 1 1 pt. 8,810
  7. Avatar for Savas 107. Savas Lv 1 1 pt. 8,799
  8. Avatar for Mohoernchen 108. Mohoernchen Lv 1 1 pt. 8,794
  9. Avatar for gabbysy 109. gabbysy Lv 1 1 pt. 8,791
  10. Avatar for dantisg 110. dantisg Lv 1 1 pt. 8,788

Comments