Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,638
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,458
  3. Avatar for BC125_Buco,Palisoc,Torre 13. BC125_Buco,Palisoc,Torre 1 pt. 9,270
  4. Avatar for Team China 14. Team China 1 pt. 8,874
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,799
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,730
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,639
  8. Avatar for pikem125 18. pikem125 1 pt. 8,613
  1. Avatar for dyrexic 111. dyrexic Lv 1 1 pt. 8,785
  2. Avatar for esdeguzman3 112. esdeguzman3 Lv 1 1 pt. 8,766
  3. Avatar for Hebrew Hitman 113. Hebrew Hitman Lv 1 1 pt. 8,759
  4. Avatar for joshmiller 114. joshmiller Lv 1 1 pt. 8,730
  5. Avatar for CharaLilith 115. CharaLilith Lv 1 1 pt. 8,721
  6. Avatar for artsyambie6 116. artsyambie6 Lv 1 1 pt. 8,713
  7. Avatar for dymytril 117. dymytril Lv 1 1 pt. 8,708
  8. Avatar for jezelion 118. jezelion Lv 1 1 pt. 8,703
  9. Avatar for BonderDaGreat 119. BonderDaGreat Lv 1 1 pt. 8,701
  10. Avatar for lacie 120. lacie Lv 1 1 pt. 8,701

Comments