Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,638
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,458
  3. Avatar for Team China 14. Team China 1 pt. 8,874
  4. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,799
  5. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,730
  6. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,639
  7. Avatar for pikem125 18. pikem125 1 pt. 8,613

  1. Avatar for Waldemar Albert 131. Waldemar Albert Lv 1 1 pt. 8,584
  2. Avatar for TidusCZ 132. TidusCZ Lv 1 1 pt. 8,472
  3. Avatar for lickington 133. lickington Lv 1 1 pt. 8,461
  4. Avatar for Danraove 134. Danraove Lv 1 1 pt. 8,438
  5. Avatar for DipsyDoodle2016 135. DipsyDoodle2016 Lv 1 1 pt. 8,377
  6. Avatar for noahthed 136. noahthed Lv 1 1 pt. 8,320
  7. Avatar for aesbear17 137. aesbear17 Lv 1 1 pt. 8,250
  8. Avatar for maleetesers 138. maleetesers Lv 1 1 pt. 8,097
  9. Avatar for lcar4808 139. lcar4808 Lv 1 1 pt. 8,019
  10. Avatar for apetrides 140. apetrides Lv 1 1 pt. 7,975

Comments