Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,638
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,458
  3. Avatar for BC125_Buco,Palisoc,Torre 13. BC125_Buco,Palisoc,Torre 1 pt. 9,270
  4. Avatar for Team China 14. Team China 1 pt. 8,874
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,799
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,730
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,639
  8. Avatar for pikem125 18. pikem125 1 pt. 8,613
  1. Avatar for Ironslav 151. Ironslav Lv 1 1 pt. 5,520
  2. Avatar for Rogertte 152. Rogertte Lv 1 1 pt. 5,511
  3. Avatar for KevinDeidad 153. KevinDeidad Lv 1 1 pt. 5,505
  4. Avatar for CH3F1-Beall 154. CH3F1-Beall Lv 1 1 pt. 5,493
  5. Avatar for scottwuzhear 155. scottwuzhear Lv 1 1 pt. 5,467
  6. Avatar for guarnieria28 156. guarnieria28 Lv 1 1 pt. 5,467
  7. Avatar for PLM.CHM3110L.G1.AY2021.22.S1 157. PLM.CHM3110L.G1.AY2021.22.S1 Lv 1 1 pt. 5,467
  8. Avatar for KJ100220 158. KJ100220 Lv 1 1 pt. 5,467
  9. Avatar for jeff101 159. jeff101 Lv 1 1 pt. 5,467
  10. Avatar for ROOZEBOOM 160. ROOZEBOOM Lv 1 1 pt. 5,467

Comments