Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,638
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,458
  3. Avatar for BC125_Buco,Palisoc,Torre 13. BC125_Buco,Palisoc,Torre 1 pt. 9,270
  4. Avatar for Team China 14. Team China 1 pt. 8,874
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,799
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,730
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,639
  8. Avatar for pikem125 18. pikem125 1 pt. 8,613
  1. Avatar for guineapig 21. guineapig Lv 1 52 pts. 10,710
  2. Avatar for Skippysk8s 22. Skippysk8s Lv 1 51 pts. 10,683
  3. Avatar for Simek 23. Simek Lv 1 49 pts. 10,681
  4. Avatar for maithra 24. maithra Lv 1 47 pts. 10,673
  5. Avatar for Galaxie 25. Galaxie Lv 1 46 pts. 10,671
  6. Avatar for infjamc 26. infjamc Lv 1 44 pts. 10,664
  7. Avatar for Punzi Baker 2 27. Punzi Baker 2 Lv 1 42 pts. 10,638
  8. Avatar for fpc 28. fpc Lv 1 41 pts. 10,635
  9. Avatar for BootsMcGraw 29. BootsMcGraw Lv 1 39 pts. 10,623
  10. Avatar for akaaka 30. akaaka Lv 1 38 pts. 10,615

Comments