Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,638
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,458
  3. Avatar for BC125_Buco,Palisoc,Torre 13. BC125_Buco,Palisoc,Torre 1 pt. 9,270
  4. Avatar for Team China 14. Team China 1 pt. 8,874
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,799
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,730
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,639
  8. Avatar for pikem125 18. pikem125 1 pt. 8,613
  1. Avatar for markoan 31. markoan Lv 1 37 pts. 10,605
  2. Avatar for phi16 32. phi16 Lv 1 35 pts. 10,558
  3. Avatar for Vinara 33. Vinara Lv 1 34 pts. 10,551
  4. Avatar for gmn 34. gmn Lv 1 33 pts. 10,536
  5. Avatar for robgee 35. robgee Lv 1 32 pts. 10,504
  6. Avatar for borattt 36. borattt Lv 1 30 pts. 10,461
  7. Avatar for alcor29 37. alcor29 Lv 1 29 pts. 10,437
  8. Avatar for Phyx 38. Phyx Lv 1 28 pts. 10,436
  9. Avatar for equilibria 39. equilibria Lv 1 27 pts. 10,415
  10. Avatar for BarrySampson 40. BarrySampson Lv 1 26 pts. 10,347

Comments