Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,638
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,458
  3. Avatar for BC125_Buco,Palisoc,Torre 13. BC125_Buco,Palisoc,Torre 1 pt. 9,270
  4. Avatar for Team China 14. Team China 1 pt. 8,874
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,799
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,730
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,639
  8. Avatar for pikem125 18. pikem125 1 pt. 8,613
  1. Avatar for latin krepin 51. latin krepin Lv 1 17 pts. 10,082
  2. Avatar for kyoota 52. kyoota Lv 1 16 pts. 10,026
  3. Avatar for NPrincipi 53. NPrincipi Lv 1 15 pts. 10,020
  4. Avatar for Hellcat6 54. Hellcat6 Lv 1 14 pts. 9,995
  5. Avatar for zackallen 55. zackallen Lv 1 14 pts. 9,973
  6. Avatar for Merf 56. Merf Lv 1 13 pts. 9,925
  7. Avatar for carsonfb 57. carsonfb Lv 1 13 pts. 9,911
  8. Avatar for carxo 58. carxo Lv 1 12 pts. 9,860
  9. Avatar for davidandersoniii 59. davidandersoniii Lv 1 12 pts. 9,783
  10. Avatar for badgoes 60. badgoes Lv 1 11 pts. 9,714

Comments