Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,638
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,458
  3. Avatar for Team China 14. Team China 1 pt. 8,874
  4. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,799
  5. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,730
  6. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,639
  7. Avatar for pikem125 18. pikem125 1 pt. 8,613

  1. Avatar for vuvuvu 61. vuvuvu Lv 1 11 pts. 9,690
  2. Avatar for rezaefar 62. rezaefar Lv 1 10 pts. 9,683
  3. Avatar for bamh 63. bamh Lv 1 10 pts. 9,645
  4. Avatar for Oransche 64. Oransche Lv 1 9 pts. 9,644
  5. Avatar for kevin everington 65. kevin everington Lv 1 9 pts. 9,643
  6. Avatar for dohkyungsushi 66. dohkyungsushi Lv 1 8 pts. 9,639
  7. Avatar for deus911 67. deus911 Lv 1 8 pts. 9,638
  8. Avatar for Trajan464 68. Trajan464 Lv 1 8 pts. 9,626
  9. Avatar for Pexiixep 69. Pexiixep Lv 1 7 pts. 9,608
  10. Avatar for MiguelPabona 70. MiguelPabona Lv 1 7 pts. 9,583

Comments