Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,199
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 11,186
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 11,123
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 11,096
  5. Avatar for Contenders 5. Contenders 27 pts. 10,758
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,744
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,683
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 10,681
  9. Avatar for Australia 9. Australia 5 pts. 10,236
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,690
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 11,199
  2. Avatar for jeff101 2. jeff101 Lv 1 65 pts. 11,186
  3. Avatar for LociOiling 3. LociOiling Lv 1 41 pts. 11,184
  4. Avatar for Galaxie 4. Galaxie Lv 1 24 pts. 11,090
  5. Avatar for fpc 5. fpc Lv 1 14 pts. 11,045
  6. Avatar for jausmh 6. jausmh Lv 1 7 pts. 11,043
  7. Avatar for phi16 7. phi16 Lv 1 4 pts. 11,029
  8. Avatar for silent gene 8. silent gene Lv 1 2 pts. 11,028
  9. Avatar for gmn 9. gmn Lv 1 1 pt. 11,026
  10. Avatar for alcor29 10. alcor29 Lv 1 1 pt. 11,004

Comments