Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Go Science 100 pts. 11,199
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 11,186
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 11,123
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 11,096
  5. Avatar for Contenders 5. Contenders 27 pts. 10,758
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,744
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,683
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 10,681
  9. Avatar for Australia 9. Australia 5 pts. 10,236
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,690

  1. Avatar for vuvuvu 61. vuvuvu Lv 1 11 pts. 9,690
  2. Avatar for rezaefar 62. rezaefar Lv 1 10 pts. 9,683
  3. Avatar for bamh 63. bamh Lv 1 10 pts. 9,645
  4. Avatar for Oransche 64. Oransche Lv 1 9 pts. 9,644
  5. Avatar for kevin everington 65. kevin everington Lv 1 9 pts. 9,643
  6. Avatar for dohkyungsushi 66. dohkyungsushi Lv 1 8 pts. 9,639
  7. Avatar for deus911 67. deus911 Lv 1 8 pts. 9,638
  8. Avatar for Trajan464 68. Trajan464 Lv 1 8 pts. 9,626
  9. Avatar for Pexiixep 69. Pexiixep Lv 1 7 pts. 9,608
  10. Avatar for MiguelPabona 70. MiguelPabona Lv 1 7 pts. 9,583

Comments