Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,199
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 11,186
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 11,123
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 11,096
  5. Avatar for Contenders 5. Contenders 27 pts. 10,758
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,744
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,683
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 10,681
  9. Avatar for Australia 9. Australia 5 pts. 10,236
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,690
  1. Avatar for Sammy3c2b1a0 141. Sammy3c2b1a0 Lv 1 1 pt. 7,974
  2. Avatar for Sandra Villaluz 142. Sandra Villaluz Lv 1 1 pt. 7,909
  3. Avatar for Lord_Sandwich 143. Lord_Sandwich Lv 1 1 pt. 7,104
  4. Avatar for qz1014123 144. qz1014123 Lv 1 1 pt. 6,344
  5. Avatar for proteineprogramer68 145. proteineprogramer68 Lv 1 1 pt. 6,315
  6. Avatar for MultiColors 146. MultiColors Lv 1 1 pt. 6,026
  7. Avatar for litoguemi 147. litoguemi Lv 1 1 pt. 5,761
  8. Avatar for Raaaffy 148. Raaaffy Lv 1 1 pt. 5,739
  9. Avatar for BENJALIPO 149. BENJALIPO Lv 1 1 pt. 5,734
  10. Avatar for Juan Carlos Vega 150. Juan Carlos Vega Lv 1 1 pt. 5,608

Comments