Placeholder image of a protein
Icon representing a puzzle

2095: Revisiting Puzzle 109: Pumpkin

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
January 13, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 2 pts. 8,707
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 8,617
  3. Avatar for Geekdo 13. Geekdo 1 pt. 8,544
  4. Avatar for Team China 14. Team China 1 pt. 8,269
  5. Avatar for pikem125 15. pikem125 1 pt. 8,206
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 7,993
  7. Avatar for test 2 17. test 2 1 pt. 7,260
  8. Avatar for METU-BIN 18. METU-BIN 1 pt. 5,095
  9. Avatar for Boilermakers 19. Boilermakers 1 pt. 5,091

  1. Avatar for Mohoernchen 91. Mohoernchen Lv 1 2 pts. 8,353
  2. Avatar for pruneau_44 92. pruneau_44 Lv 1 2 pts. 8,351
  3. Avatar for GraVT 93. GraVT Lv 1 2 pts. 8,350
  4. Avatar for arcticdriver 94. arcticdriver Lv 1 2 pts. 8,316
  5. Avatar for LELE1964 95. LELE1964 Lv 1 2 pts. 8,315
  6. Avatar for biologist666 96. biologist666 Lv 1 1 pt. 8,277
  7. Avatar for zo3xiaJonWeinberg 97. zo3xiaJonWeinberg Lv 1 1 pt. 8,269
  8. Avatar for froschi2 98. froschi2 Lv 1 1 pt. 8,264
  9. Avatar for Theiavolution 99. Theiavolution Lv 1 1 pt. 8,263
  10. Avatar for Amylase2.0 100. Amylase2.0 Lv 1 1 pt. 8,249

Comments


LociOiling Lv 1

That tau knot is not a good knot, but I was thinking gourds, not Gords, eh?

I learn something new every day here in Foldit-land. I previously might have thought tauopathy had something to do with taupe, but nope.

What is taupe? Wikipedia as usual has an answer:

The name originally referred only to the average color of the French mole,
but beginning in the 1940s, its usage expanded to encompass a wider range of shades.

Glad they could clarify that. I'm still concerned about that mole, even if it is only average.

On Tau-Extremal front, I'm trying the recipe, but I'm still not exactly sure what it does. I was just intimidated by the name.

I've never understood why the pumpkin puzzle has only 44 segments, where the PDB entries have 68. (Or 1TIN has 68, at least.) Seems like a creative approach might be more effective than trying to match a known solution when you have only 66% of the segments.