2095: Revisiting Puzzle 109: Pumpkin

Closed since about 4 years ago

Summary

• Created: January 13, 2022
• Expires: January 20, 2022 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:

SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

• 1. Anthropic Dreams 100 pts. 9,323
• 2. Go Science 76 pts. 9,308
• 3. Beta Folders 56 pts. 9,283
• 4. Contenders 41 pts. 9,211
• 5. L'Alliance Francophone 29 pts. 9,183
• 6. Marvin's bunch 20 pts. 9,161
• 7. AlphaFold 14 pts. 9,023
• 8. Void Crushers 9 pts. 9,022
• 9. Australia 6 pts. 8,904
• 10. Czech National Team 4 pts. 8,841

Top soloists

• 1. grogar7 100 pts. 9,323
• 2. NinjaGreg 97 pts. 9,308
• 3. Bruno Kestemont 94 pts. 9,290
• 4. LociOiling 91 pts. 9,283
• 5. MicElephant 88 pts. 9,240
• 6. robgee 86 pts. 9,211
• 7. guineapig 83 pts. 9,206
• 8. BootsMcGraw 80 pts. 9,189
• 9. jobo0502 77 pts. 9,183
• 10. Punzi Baker 2 75 pts. 9,176

Comments

[LociOiling]

https://foldit.fandom.com/wiki/Revisiting_puzzle/109:_Pumpkin

[Vincera]

Greetings, Loci!
Is this the same GK to which you refer?:

Dissolving the Gordian Knot
A ‘druggable’ mechanism of tau protein pathology could lead to new treatment for some of our most devastating neurodegenerative diseases

https://www.news.ucsb.edu/2019/019394/dissolving-gordian-knot

Have you found @CharaLilith's "Tau-Extremal Optimization" recipe (ID 105093) to be useful for the pumpkin puzzle? https://fold.it/portal/recipe/105093

[LociOiling]

That tau knot is not a good knot, but I was thinking gourds, not Gords, eh?

I learn something new every day here in Foldit-land. I previously might have thought tauopathy had something to do with taupe, but nope.

What is taupe? Wikipedia as usual has an answer:

The name originally referred only to the average color of the French mole,
but beginning in the 1940s, its usage expanded to encompass a wider range of shades.

Glad they could clarify that. I'm still concerned about that mole, even if it is only average.

On Tau-Extremal front, I'm trying the recipe, but I'm still not exactly sure what it does. I was just intimidated by the name.

I've never understood why the pumpkin puzzle has only 44 segments, where the PDB entries have 68. (Or 1TIN has 68, at least.) Seems like a creative approach might be more effective than trying to match a known solution when you have only 66% of the segments.