2095: Revisiting Puzzle 109: Pumpkin
Closed since about 4 years ago
Novice Overall PredictionSummary
- Created
- January 13, 2022
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.
Sequence:
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK
Top groups
-
100 pts. 9,323
-
-
-
-
-
-
-
-
-
-
1. Galaxie Lv 1100 pts. 9,322 -
-
-
-
-
-
-
-
-
Comments
Vincera Lv 1
Greetings, Loci!
Is this the same GK to which you refer?:
Dissolving the Gordian Knot
A ‘druggable’ mechanism of tau protein pathology could lead to new treatment for some of our most devastating neurodegenerative diseases
https://www.news.ucsb.edu/2019/019394/dissolving-gordian-knot
Have you found @CharaLilith's "Tau-Extremal Optimization" recipe (ID 105093) to be useful for the pumpkin puzzle? https://fold.it/portal/recipe/105093
LociOiling Lv 1
That tau knot is not a good knot, but I was thinking gourds, not Gords, eh?
I learn something new every day here in Foldit-land. I previously might have thought tauopathy had something to do with taupe, but nope.
What is taupe? Wikipedia as usual has an answer:
The name originally referred only to the average color of the French mole, but beginning in the 1940s, its usage expanded to encompass a wider range of shades.
Glad they could clarify that. I'm still concerned about that mole, even if it is only average.
On Tau-Extremal front, I'm trying the recipe, but I'm still not exactly sure what it does. I was just intimidated by the name.
I've never understood why the pumpkin puzzle has only 44 segments, where the PDB entries have 68. (Or 1TIN has 68, at least.) Seems like a creative approach might be more effective than trying to match a known solution when you have only 66% of the segments.