Placeholder image of a protein
Icon representing a puzzle

2095: Revisiting Puzzle 109: Pumpkin

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 13, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,323
  2. Avatar for Go Science 2. Go Science 76 pts. 9,308
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,283
  4. Avatar for Contenders 4. Contenders 41 pts. 9,211
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 9,183
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 9,161
  7. Avatar for AlphaFold 7. AlphaFold 14 pts. 9,023
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,022
  9. Avatar for Australia 9. Australia 6 pts. 8,904
  10. Avatar for Czech National Team 10. Czech National Team 4 pts. 8,841

  1. Avatar for Elizabeth33 131. Elizabeth33 Lv 1 1 pt. 7,724
  2. Avatar for pr0tfold 132. pr0tfold Lv 1 1 pt. 7,703
  3. Avatar for kevin cely 133. kevin cely Lv 1 1 pt. 7,519
  4. Avatar for Riccardo161020 134. Riccardo161020 Lv 1 1 pt. 7,514
  5. Avatar for fiendish_ghoul 135. fiendish_ghoul Lv 1 1 pt. 7,311
  6. Avatar for joshtest01 136. joshtest01 Lv 1 1 pt. 7,260
  7. Avatar for nagistick 137. nagistick Lv 1 1 pt. 7,206
  8. Avatar for tinta 138. tinta Lv 1 1 pt. 7,176
  9. Avatar for AlcoholicA 139. AlcoholicA Lv 1 1 pt. 7,169
  10. Avatar for manolichi56 140. manolichi56 Lv 1 1 pt. 6,312

Comments


LociOiling Lv 1

That tau knot is not a good knot, but I was thinking gourds, not Gords, eh?

I learn something new every day here in Foldit-land. I previously might have thought tauopathy had something to do with taupe, but nope.

What is taupe? Wikipedia as usual has an answer:

The name originally referred only to the average color of the French mole,
but beginning in the 1940s, its usage expanded to encompass a wider range of shades.

Glad they could clarify that. I'm still concerned about that mole, even if it is only average.

On Tau-Extremal front, I'm trying the recipe, but I'm still not exactly sure what it does. I was just intimidated by the name.

I've never understood why the pumpkin puzzle has only 44 segments, where the PDB entries have 68. (Or 1TIN has 68, at least.) Seems like a creative approach might be more effective than trying to match a known solution when you have only 66% of the segments.