Placeholder image of a protein
Icon representing a puzzle

2095: Revisiting Puzzle 109: Pumpkin

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
January 13, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,323
  2. Avatar for Go Science 2. Go Science 76 pts. 9,308
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,283
  4. Avatar for Contenders 4. Contenders 41 pts. 9,211
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 9,183
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 9,161
  7. Avatar for AlphaFold 7. AlphaFold 14 pts. 9,023
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,022
  9. Avatar for Australia 9. Australia 6 pts. 8,904
  10. Avatar for Czech National Team 10. Czech National Team 4 pts. 8,841

  1. Avatar for RockOn 11. RockOn Lv 1 72 pts. 9,175
  2. Avatar for gmn 12. gmn Lv 1 70 pts. 9,166
  3. Avatar for frood66 13. frood66 Lv 1 68 pts. 9,159
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 65 pts. 9,156
  5. Avatar for BarrySampson 15. BarrySampson Lv 1 63 pts. 9,152
  6. Avatar for borattt 16. borattt Lv 1 61 pts. 9,147
  7. Avatar for Deleted player 17. Deleted player pts. 9,141
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 57 pts. 9,118
  9. Avatar for Galaxie 19. Galaxie Lv 1 55 pts. 9,115
  10. Avatar for g_b 20. g_b Lv 1 53 pts. 9,099

Comments


LociOiling Lv 1

That tau knot is not a good knot, but I was thinking gourds, not Gords, eh?

I learn something new every day here in Foldit-land. I previously might have thought tauopathy had something to do with taupe, but nope.

What is taupe? Wikipedia as usual has an answer:

The name originally referred only to the average color of the French mole,
but beginning in the 1940s, its usage expanded to encompass a wider range of shades.

Glad they could clarify that. I'm still concerned about that mole, even if it is only average.

On Tau-Extremal front, I'm trying the recipe, but I'm still not exactly sure what it does. I was just intimidated by the name.

I've never understood why the pumpkin puzzle has only 44 segments, where the PDB entries have 68. (Or 1TIN has 68, at least.) Seems like a creative approach might be more effective than trying to match a known solution when you have only 66% of the segments.