Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,410
  2. Avatar for 2022_MUfolders 12. 2022_MUfolders 1 pt. 9,221
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 9,156
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,528
  5. Avatar for Team China 15. Team China 1 pt. 8,075
  6. Avatar for test 2 16. test 2 1 pt. 5,122

  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,599
  2. Avatar for Deleted player 2. Deleted player pts. 10,500
  3. Avatar for Bletchley Park 3. Bletchley Park Lv 1 95 pts. 10,473
  4. Avatar for LociOiling 4. LociOiling Lv 1 92 pts. 10,460
  5. Avatar for Punzi Baker 2 5. Punzi Baker 2 Lv 1 90 pts. 10,443
  6. Avatar for grogar7 6. grogar7 Lv 1 87 pts. 10,438
  7. Avatar for Galaxie 7. Galaxie Lv 1 85 pts. 10,428
  8. Avatar for g_b 8. g_b Lv 1 82 pts. 10,403
  9. Avatar for BootsMcGraw 9. BootsMcGraw Lv 1 80 pts. 10,393
  10. Avatar for silent gene 10. silent gene Lv 1 78 pts. 10,389

Comments