Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Go Science 100 pts. 10,599
  2. Avatar for Contenders 2. Contenders 71 pts. 10,473
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,464
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,450
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,384
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,312
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,287
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,244
  9. Avatar for Australia 9. Australia 3 pts. 9,702
  10. Avatar for Russian team 10. Russian team 2 pts. 9,570

  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,599
  2. Avatar for Deleted player 2. Deleted player pts. 10,500
  3. Avatar for Bletchley Park 3. Bletchley Park Lv 1 95 pts. 10,473
  4. Avatar for LociOiling 4. LociOiling Lv 1 92 pts. 10,460
  5. Avatar for Punzi Baker 2 5. Punzi Baker 2 Lv 1 90 pts. 10,443
  6. Avatar for grogar7 6. grogar7 Lv 1 87 pts. 10,438
  7. Avatar for Galaxie 7. Galaxie Lv 1 85 pts. 10,428
  8. Avatar for g_b 8. g_b Lv 1 82 pts. 10,403
  9. Avatar for BootsMcGraw 9. BootsMcGraw Lv 1 80 pts. 10,393
  10. Avatar for silent gene 10. silent gene Lv 1 78 pts. 10,389

Comments