Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Go Science 100 pts. 10,599
  2. Avatar for Contenders 2. Contenders 71 pts. 10,473
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,464
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,450
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,384
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,312
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,287
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,244
  9. Avatar for Australia 9. Australia 3 pts. 9,702
  10. Avatar for Russian team 10. Russian team 2 pts. 9,570

  1. Avatar for infjamc 51. infjamc Lv 1 20 pts. 9,831
  2. Avatar for Merf 52. Merf Lv 1 19 pts. 9,829
  3. Avatar for Deleted player 53. Deleted player 18 pts. 9,824
  4. Avatar for zippyc137 54. zippyc137 Lv 1 17 pts. 9,776
  5. Avatar for Oransche 55. Oransche Lv 1 17 pts. 9,776
  6. Avatar for jausmh 56. jausmh Lv 1 16 pts. 9,747
  7. Avatar for carxo 57. carxo Lv 1 15 pts. 9,725
  8. Avatar for Larini 58. Larini Lv 1 15 pts. 9,721
  9. Avatar for phi16 59. phi16 Lv 1 14 pts. 9,702
  10. Avatar for AlkiP0Ps 60. AlkiP0Ps Lv 1 14 pts. 9,702

Comments