Placeholder image of a protein
Icon representing a puzzle

2101: Revisiting Puzzle 111: Mouse

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 27, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,479
  2. Avatar for foldeRNA 12. foldeRNA 1 pt. 9,429
  3. Avatar for Team China 13. Team China 1 pt. 9,079
  4. Avatar for Window Group 14. Window Group 1 pt. 7,924
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 6,972
  6. Avatar for G10 Biology LSNepal 2022 16. G10 Biology LSNepal 2022 1 pt. 5,048
  7. Avatar for test 2 17. test 2 1 pt. 5,020
  1. Avatar for burgessmargaret 171. burgessmargaret Lv 1 1 pt. 5,020
  2. Avatar for paigesmith17 172. paigesmith17 Lv 1 1 pt. 5,020
  3. Avatar for ashley.hinrichs 173. ashley.hinrichs Lv 1 1 pt. 5,020
  4. Avatar for bkoep 174. bkoep Lv 1 1 pt. 5,020
  5. Avatar for kaylut 175. kaylut Lv 1 1 pt. 5,020
  6. Avatar for mbaratal 176. mbaratal Lv 1 1 pt. 5,020
  7. Avatar for kalDima 177. kalDima Lv 1 1 pt. 5,020

Comments