Placeholder image of a protein
Icon representing a puzzle

2107: Revisiting Puzzle 113: White Birch

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
February 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Otterbein Bioinformatics 2022 11. Otterbein Bioinformatics 2022 1 pt. 9,280
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 9,202
  3. Avatar for Team China 13. Team China 1 pt. 9,008
  4. Avatar for UML BMEN.4100 14. UML BMEN.4100 1 pt. 5,520
  5. Avatar for Mustang AP Biology 2022 15. Mustang AP Biology 2022 1 pt. 5,520
  1. Avatar for Simek 51. Simek Lv 1 11 pts. 10,262
  2. Avatar for Anfinsen_slept_here 52. Anfinsen_slept_here Lv 1 11 pts. 10,245
  3. Avatar for heather-1 53. heather-1 Lv 1 10 pts. 10,213
  4. Avatar for NPrincipi 54. NPrincipi Lv 1 10 pts. 10,189
  5. Avatar for kevin everington 55. kevin everington Lv 1 9 pts. 10,184
  6. Avatar for NeLikomSheet 56. NeLikomSheet Lv 1 9 pts. 10,182
  7. Avatar for Trajan464 57. Trajan464 Lv 1 8 pts. 10,125
  8. Avatar for Beany 58. Beany Lv 1 8 pts. 10,109
  9. Avatar for frostschutz 59. frostschutz Lv 1 7 pts. 10,088
  10. Avatar for wudoo 60. wudoo Lv 1 7 pts. 10,084

Comments