Placeholder image of a protein
Icon representing a puzzle

2107: Revisiting Puzzle 113: White Birch

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,963
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,849
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 10,842
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,786
  5. Avatar for Contenders 5. Contenders 19 pts. 10,786
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,695
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,649
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 10,305
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 10,262
  10. Avatar for Australia 10. Australia 1 pt. 9,953
  1. Avatar for Simek 51. Simek Lv 1 11 pts. 10,262
  2. Avatar for Anfinsen_slept_here 52. Anfinsen_slept_here Lv 1 11 pts. 10,245
  3. Avatar for heather-1 53. heather-1 Lv 1 10 pts. 10,213
  4. Avatar for NPrincipi 54. NPrincipi Lv 1 10 pts. 10,189
  5. Avatar for kevin everington 55. kevin everington Lv 1 9 pts. 10,184
  6. Avatar for NeLikomSheet 56. NeLikomSheet Lv 1 9 pts. 10,182
  7. Avatar for Trajan464 57. Trajan464 Lv 1 8 pts. 10,125
  8. Avatar for Beany 58. Beany Lv 1 8 pts. 10,109
  9. Avatar for frostschutz 59. frostschutz Lv 1 7 pts. 10,088
  10. Avatar for wudoo 60. wudoo Lv 1 7 pts. 10,084

Comments