2107: Revisiting Puzzle 113: White Birch
Closed since about 4 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- February 10, 2022
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
Sequence:
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF
Top groups
Comments