Placeholder image of a protein
Icon representing a puzzle

2107: Revisiting Puzzle 113: White Birch

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,963
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,849
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 10,842
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,786
  5. Avatar for Contenders 5. Contenders 19 pts. 10,786
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,695
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,649
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 10,305
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 10,262
  10. Avatar for Australia 10. Australia 1 pt. 9,953
  1. Avatar for cjddig 81. cjddig Lv 1 2 pts. 9,570
  2. Avatar for froschi2 82. froschi2 Lv 1 2 pts. 9,517
  3. Avatar for rinze 83. rinze Lv 1 2 pts. 9,508
  4. Avatar for jessi00tran 84. jessi00tran Lv 1 2 pts. 9,465
  5. Avatar for BPS_digiovanni_2020 85. BPS_digiovanni_2020 Lv 1 2 pts. 9,448
  6. Avatar for hajtogato 86. hajtogato Lv 1 1 pt. 9,415
  7. Avatar for apetrides 87. apetrides Lv 1 1 pt. 9,413
  8. Avatar for Alex333 88. Alex333 Lv 1 1 pt. 9,408
  9. Avatar for Juronik 89. Juronik Lv 1 1 pt. 9,356
  10. Avatar for slashjonnie 90. slashjonnie Lv 1 1 pt. 9,354

Comments