Placeholder image of a protein
Icon representing a puzzle

2108: Electron Density Reconstruction 4

Closed since about 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
February 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes three sulfate ions that are fixed in place.



Sequence:


KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 18,731
  2. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 18,096
  3. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 5,552

  1. Avatar for Visok 11. Visok Lv 1 61 pts. 19,755
  2. Avatar for grogar7 12. grogar7 Lv 1 58 pts. 19,753
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 55 pts. 19,739
  4. Avatar for MicElephant 14. MicElephant Lv 1 52 pts. 19,727
  5. Avatar for guineapig 15. guineapig Lv 1 49 pts. 19,714
  6. Avatar for Skippysk8s 16. Skippysk8s Lv 1 47 pts. 19,713
  7. Avatar for Punzi Baker 2 17. Punzi Baker 2 Lv 1 44 pts. 19,700
  8. Avatar for maithra 18. maithra Lv 1 42 pts. 19,691
  9. Avatar for ucad 19. ucad Lv 1 40 pts. 19,679
  10. Avatar for dizzywings 20. dizzywings Lv 1 37 pts. 19,653

Comments