Placeholder image of a protein
Icon representing a puzzle

2108: Electron Density Reconstruction 4

Closed since about 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes three sulfate ions that are fixed in place.



Sequence:


KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 20,122
  2. Avatar for Go Science 2. Go Science 68 pts. 20,053
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 19,990
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 19,990
  5. Avatar for Contenders 5. Contenders 16 pts. 19,968
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 19,840
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 19,713
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 19,552
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 19,461
  10. Avatar for VeFold 10. VeFold 1 pt. 18,879
  1. Avatar for Visok 11. Visok Lv 1 61 pts. 19,755
  2. Avatar for grogar7 12. grogar7 Lv 1 58 pts. 19,753
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 55 pts. 19,739
  4. Avatar for MicElephant 14. MicElephant Lv 1 52 pts. 19,727
  5. Avatar for guineapig 15. guineapig Lv 1 49 pts. 19,714
  6. Avatar for Skippysk8s 16. Skippysk8s Lv 1 47 pts. 19,713
  7. Avatar for Punzi Baker 2 17. Punzi Baker 2 Lv 1 44 pts. 19,700
  8. Avatar for maithra 18. maithra Lv 1 42 pts. 19,691
  9. Avatar for ucad 19. ucad Lv 1 40 pts. 19,679
  10. Avatar for dizzywings 20. dizzywings Lv 1 37 pts. 19,653

Comments