Placeholder image of a protein
Icon representing a puzzle

2108: Electron Density Reconstruction 4

Closed since about 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes three sulfate ions that are fixed in place.



Sequence:


KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 18,731
  2. Avatar for BIOB101 - Discover Biology 12. BIOB101 - Discover Biology 1 pt. 18,231
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 18,096
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 5,552
  1. Avatar for ProfVince 31. ProfVince Lv 1 19 pts. 19,477
  2. Avatar for Mike Cassidy 32. Mike Cassidy Lv 1 18 pts. 19,461
  3. Avatar for jobo0502 33. jobo0502 Lv 1 17 pts. 19,446
  4. Avatar for Vinara 34. Vinara Lv 1 16 pts. 19,431
  5. Avatar for georg137 35. georg137 Lv 1 15 pts. 19,404
  6. Avatar for Arthuriel 36. Arthuriel Lv 1 14 pts. 19,383
  7. Avatar for jausmh 37. jausmh Lv 1 13 pts. 19,379
  8. Avatar for equilibria 38. equilibria Lv 1 12 pts. 19,358
  9. Avatar for fiendish_ghoul 39. fiendish_ghoul Lv 1 11 pts. 19,344
  10. Avatar for Sandrix72 40. Sandrix72 Lv 1 10 pts. 19,323

Comments