Placeholder image of a protein
Icon representing a puzzle

2108: Electron Density Reconstruction 4

Closed since about 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes three sulfate ions that are fixed in place.



Sequence:


KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 20,122
  2. Avatar for Go Science 2. Go Science 68 pts. 20,053
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 19,990
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 19,990
  5. Avatar for Contenders 5. Contenders 16 pts. 19,968
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 19,840
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 19,713
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 19,552
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 19,461
  10. Avatar for VeFold 10. VeFold 1 pt. 18,879
  1. Avatar for ProfVince 31. ProfVince Lv 1 19 pts. 19,477
  2. Avatar for Mike Cassidy 32. Mike Cassidy Lv 1 18 pts. 19,461
  3. Avatar for jobo0502 33. jobo0502 Lv 1 17 pts. 19,446
  4. Avatar for Vinara 34. Vinara Lv 1 16 pts. 19,431
  5. Avatar for georg137 35. georg137 Lv 1 15 pts. 19,404
  6. Avatar for Arthuriel 36. Arthuriel Lv 1 14 pts. 19,383
  7. Avatar for jausmh 37. jausmh Lv 1 13 pts. 19,379
  8. Avatar for equilibria 38. equilibria Lv 1 12 pts. 19,358
  9. Avatar for fiendish_ghoul 39. fiendish_ghoul Lv 1 11 pts. 19,344
  10. Avatar for Sandrix72 40. Sandrix72 Lv 1 10 pts. 19,323

Comments