Placeholder image of a protein
Icon representing a puzzle

2108: Electron Density Reconstruction 4

Closed since about 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes three sulfate ions that are fixed in place.



Sequence:


KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 18,731
  2. Avatar for BIOB101 - Discover Biology 12. BIOB101 - Discover Biology 1 pt. 18,231
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 18,096
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 5,552
  1. Avatar for ZeroLeak7 81. ZeroLeak7 Lv 1 1 pt. 18,073
  2. Avatar for CParfrey 82. CParfrey Lv 1 1 pt. 18,002
  3. Avatar for Joepocalypse 83. Joepocalypse Lv 1 1 pt. 17,886
  4. Avatar for heyubob 84. heyubob Lv 1 1 pt. 17,621
  5. Avatar for justindang 85. justindang Lv 1 1 pt. 17,469
  6. Avatar for frostschutz 86. frostschutz Lv 1 1 pt. 17,208
  7. Avatar for evifnoskcaj 87. evifnoskcaj Lv 1 1 pt. 17,113
  8. Avatar for jamiexq 88. jamiexq Lv 1 1 pt. 16,069
  9. Avatar for Kekeice 89. Kekeice Lv 1 1 pt. 12,581
  10. Avatar for 098767644657tr47790856 90. 098767644657tr47790856 Lv 1 1 pt. 12,347

Comments