Placeholder image of a protein
Icon representing a puzzle

2108: Electron Density Reconstruction 4

Closed since about 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes three sulfate ions that are fixed in place.



Sequence:


KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 20,122
  2. Avatar for Go Science 2. Go Science 68 pts. 20,053
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 19,990
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 19,990
  5. Avatar for Contenders 5. Contenders 16 pts. 19,968
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 19,840
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 19,713
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 19,552
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 19,461
  10. Avatar for VeFold 10. VeFold 1 pt. 18,879
  1. Avatar for ZeroLeak7 81. ZeroLeak7 Lv 1 1 pt. 18,073
  2. Avatar for CParfrey 82. CParfrey Lv 1 1 pt. 18,002
  3. Avatar for Joepocalypse 83. Joepocalypse Lv 1 1 pt. 17,886
  4. Avatar for heyubob 84. heyubob Lv 1 1 pt. 17,621
  5. Avatar for justindang 85. justindang Lv 1 1 pt. 17,469
  6. Avatar for frostschutz 86. frostschutz Lv 1 1 pt. 17,208
  7. Avatar for evifnoskcaj 87. evifnoskcaj Lv 1 1 pt. 17,113
  8. Avatar for jamiexq 88. jamiexq Lv 1 1 pt. 16,069
  9. Avatar for Kekeice 89. Kekeice Lv 1 1 pt. 12,581
  10. Avatar for 098767644657tr47790856 90. 098767644657tr47790856 Lv 1 1 pt. 12,347

Comments