Placeholder image of a protein
Icon representing a puzzle

2108: Electron Density Reconstruction 4

Closed since about 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes three sulfate ions that are fixed in place.



Sequence:


KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 20,122
  2. Avatar for Go Science 2. Go Science 68 pts. 20,053
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 19,990
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 19,990
  5. Avatar for Contenders 5. Contenders 16 pts. 19,968
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 19,840
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 19,713
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 19,552
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 19,461
  10. Avatar for VeFold 10. VeFold 1 pt. 18,879
  1. Avatar for imgil25 101. imgil25 Lv 1 1 pt. 5,552
  2. Avatar for JintaA 102. JintaA Lv 1 1 pt. 5,552
  3. Avatar for Deleted player 103. Deleted player 1 pt. 5,552
  4. Avatar for shogi 104. shogi Lv 1 1 pt. 5,552
  5. Avatar for rmoretti 105. rmoretti Lv 1 1 pt. 5,552
  6. Avatar for Sciren 106. Sciren Lv 1 1 pt. 5,552

Comments