Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 2 pts. 9,396
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,092
  3. Avatar for BITS_215_22 13. BITS_215_22 1 pt. 8,705
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 8,522
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 6,352
  7. Avatar for test 2 17. test 2 1 pt. 6,348
  8. Avatar for Lakeland BIO353 18. Lakeland BIO353 1 pt. 6,348
  1. Avatar for Mohoernchen 91. Mohoernchen Lv 1 3 pts. 9,250
  2. Avatar for Agupta1999 92. Agupta1999 Lv 1 3 pts. 9,236
  3. Avatar for Avni_28 93. Avni_28 Lv 1 3 pts. 9,199
  4. Avatar for CaptainCupcake 94. CaptainCupcake Lv 1 3 pts. 9,195
  5. Avatar for jimit04 95. jimit04 Lv 1 2 pts. 9,186
  6. Avatar for soumil.ghosh 96. soumil.ghosh Lv 1 2 pts. 9,161
  7. Avatar for player_X 97. player_X Lv 1 2 pts. 9,148
  8. Avatar for rosengarg 98. rosengarg Lv 1 2 pts. 9,147
  9. Avatar for Sammy3c2b1a0 99. Sammy3c2b1a0 Lv 1 2 pts. 9,143
  10. Avatar for satyajit234 100. satyajit234 Lv 1 2 pts. 9,131

Comments