Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 11,278
  2. Avatar for Go Science 2. Go Science 74 pts. 11,269
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,233
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,219
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,029
  6. Avatar for Contenders 6. Contenders 18 pts. 11,018
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 11,013
  8. Avatar for Australia 8. Australia 8 pts. 10,255
  9. Avatar for Foldit Staff 9. Foldit Staff 5 pts. 9,515
  10. Avatar for BIOF215 10. BIOF215 3 pts. 9,452
  1. Avatar for Mohoernchen 91. Mohoernchen Lv 1 3 pts. 9,250
  2. Avatar for Agupta1999 92. Agupta1999 Lv 1 3 pts. 9,236
  3. Avatar for Avni_28 93. Avni_28 Lv 1 3 pts. 9,199
  4. Avatar for CaptainCupcake 94. CaptainCupcake Lv 1 3 pts. 9,195
  5. Avatar for jimit04 95. jimit04 Lv 1 2 pts. 9,186
  6. Avatar for soumil.ghosh 96. soumil.ghosh Lv 1 2 pts. 9,161
  7. Avatar for player_X 97. player_X Lv 1 2 pts. 9,148
  8. Avatar for rosengarg 98. rosengarg Lv 1 2 pts. 9,147
  9. Avatar for Sammy3c2b1a0 99. Sammy3c2b1a0 Lv 1 2 pts. 9,143
  10. Avatar for satyajit234 100. satyajit234 Lv 1 2 pts. 9,131

Comments