Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 2 pts. 9,396
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,092
  3. Avatar for BITS_215_22 13. BITS_215_22 1 pt. 8,705
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 8,522
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 6,352
  7. Avatar for test 2 17. test 2 1 pt. 6,348
  8. Avatar for Lakeland BIO353 18. Lakeland BIO353 1 pt. 6,348
  1. Avatar for dewhi100 121. dewhi100 Lv 1 1 pt. 8,406
  2. Avatar for rmoretti 122. rmoretti Lv 1 1 pt. 8,391
  3. Avatar for Jake olson 123. Jake olson Lv 1 1 pt. 8,391
  4. Avatar for melika 124. melika Lv 1 1 pt. 8,350
  5. Avatar for tinab24 125. tinab24 Lv 1 1 pt. 8,241
  6. Avatar for TaboadaUh 126. TaboadaUh Lv 1 1 pt. 8,218
  7. Avatar for shawand004 127. shawand004 Lv 1 1 pt. 8,159
  8. Avatar for mohammadmehdi.mehrian 128. mohammadmehdi.mehrian Lv 1 1 pt. 8,152
  9. Avatar for Wiz kid 129. Wiz kid Lv 1 1 pt. 8,046
  10. Avatar for jflat06 130. jflat06 Lv 1 1 pt. 7,774

Comments