Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 11,278
  2. Avatar for Go Science 2. Go Science 74 pts. 11,269
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,233
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,219
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,029
  6. Avatar for Contenders 6. Contenders 18 pts. 11,018
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 11,013
  8. Avatar for Australia 8. Australia 8 pts. 10,255
  9. Avatar for Foldit Staff 9. Foldit Staff 5 pts. 9,515
  10. Avatar for BIOF215 10. BIOF215 3 pts. 9,452
  1. Avatar for dewhi100 121. dewhi100 Lv 1 1 pt. 8,406
  2. Avatar for rmoretti 122. rmoretti Lv 1 1 pt. 8,391
  3. Avatar for Jake olson 123. Jake olson Lv 1 1 pt. 8,391
  4. Avatar for melika 124. melika Lv 1 1 pt. 8,350
  5. Avatar for tinab24 125. tinab24 Lv 1 1 pt. 8,241
  6. Avatar for TaboadaUh 126. TaboadaUh Lv 1 1 pt. 8,218
  7. Avatar for shawand004 127. shawand004 Lv 1 1 pt. 8,159
  8. Avatar for mohammadmehdi.mehrian 128. mohammadmehdi.mehrian Lv 1 1 pt. 8,152
  9. Avatar for Wiz kid 129. Wiz kid Lv 1 1 pt. 8,046
  10. Avatar for jflat06 130. jflat06 Lv 1 1 pt. 7,774

Comments