Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 2 pts. 9,396
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,092
  3. Avatar for BITS_215_22 13. BITS_215_22 1 pt. 8,705
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 8,522
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 6,352
  7. Avatar for test 2 17. test 2 1 pt. 6,348
  8. Avatar for Lakeland BIO353 18. Lakeland BIO353 1 pt. 6,348
  1. Avatar for hitesh_3288 131. hitesh_3288 Lv 1 1 pt. 7,640
  2. Avatar for tedtkim93 132. tedtkim93 Lv 1 1 pt. 7,575
  3. Avatar for PJBROS 133. PJBROS Lv 1 1 pt. 7,467
  4. Avatar for joshmiller 134. joshmiller Lv 1 1 pt. 7,445
  5. Avatar for MikeeG 135. MikeeG Lv 1 1 pt. 7,331
  6. Avatar for abheesh2647 136. abheesh2647 Lv 1 1 pt. 7,280
  7. Avatar for tiarita 137. tiarita Lv 1 1 pt. 6,835
  8. Avatar for apoorv10 138. apoorv10 Lv 1 1 pt. 6,729
  9. Avatar for Jessica Aracely 139. Jessica Aracely Lv 1 1 pt. 6,710
  10. Avatar for ms.alex.bio 140. ms.alex.bio Lv 1 1 pt. 6,533

Comments