Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 11,278
  2. Avatar for Go Science 2. Go Science 74 pts. 11,269
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,233
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,219
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,029
  6. Avatar for Contenders 6. Contenders 18 pts. 11,018
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 11,013
  8. Avatar for Australia 8. Australia 8 pts. 10,255
  9. Avatar for Foldit Staff 9. Foldit Staff 5 pts. 9,515
  10. Avatar for BIOF215 10. BIOF215 3 pts. 9,452
  1. Avatar for hitesh_3288 131. hitesh_3288 Lv 1 1 pt. 7,640
  2. Avatar for tedtkim93 132. tedtkim93 Lv 1 1 pt. 7,575
  3. Avatar for PJBROS 133. PJBROS Lv 1 1 pt. 7,467
  4. Avatar for joshmiller 134. joshmiller Lv 1 1 pt. 7,445
  5. Avatar for MikeeG 135. MikeeG Lv 1 1 pt. 7,331
  6. Avatar for abheesh2647 136. abheesh2647 Lv 1 1 pt. 7,280
  7. Avatar for tiarita 137. tiarita Lv 1 1 pt. 6,835
  8. Avatar for apoorv10 138. apoorv10 Lv 1 1 pt. 6,729
  9. Avatar for Jessica Aracely 139. Jessica Aracely Lv 1 1 pt. 6,710
  10. Avatar for ms.alex.bio 140. ms.alex.bio Lv 1 1 pt. 6,533

Comments