Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 2 pts. 9,396
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,092
  3. Avatar for BITS_215_22 13. BITS_215_22 1 pt. 8,705
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 8,522
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 6,352
  7. Avatar for test 2 17. test 2 1 pt. 6,348
  8. Avatar for Lakeland BIO353 18. Lakeland BIO353 1 pt. 6,348
  1. Avatar for jamiexq 21. jamiexq Lv 1 55 pts. 10,968
  2. Avatar for maithra 22. maithra Lv 1 53 pts. 10,950
  3. Avatar for WBarme1234 23. WBarme1234 Lv 1 51 pts. 10,940
  4. Avatar for ucad 24. ucad Lv 1 50 pts. 10,922
  5. Avatar for Vinara 25. Vinara Lv 1 48 pts. 10,920
  6. Avatar for robgee 26. robgee Lv 1 46 pts. 10,906
  7. Avatar for BootsMcGraw 27. BootsMcGraw Lv 1 45 pts. 10,895
  8. Avatar for infjamc 28. infjamc Lv 1 43 pts. 10,886
  9. Avatar for Sandrix72 29. Sandrix72 Lv 1 42 pts. 10,879
  10. Avatar for fiendish_ghoul 30. fiendish_ghoul Lv 1 40 pts. 10,875

Comments