Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Marvin's bunch 100 pts. 11,278
  2. Avatar for Go Science 2. Go Science 74 pts. 11,269
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,233
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,219
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,029
  6. Avatar for Contenders 6. Contenders 18 pts. 11,018
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 11,013
  8. Avatar for Australia 8. Australia 8 pts. 10,255
  9. Avatar for Foldit Staff 9. Foldit Staff 5 pts. 9,515
  10. Avatar for BIOF215 10. BIOF215 3 pts. 9,452

  1. Avatar for jamiexq 21. jamiexq Lv 1 55 pts. 10,968
  2. Avatar for maithra 22. maithra Lv 1 53 pts. 10,950
  3. Avatar for WBarme1234 23. WBarme1234 Lv 1 51 pts. 10,940
  4. Avatar for ucad 24. ucad Lv 1 50 pts. 10,922
  5. Avatar for Vinara 25. Vinara Lv 1 48 pts. 10,920
  6. Avatar for robgee 26. robgee Lv 1 46 pts. 10,906
  7. Avatar for BootsMcGraw 27. BootsMcGraw Lv 1 45 pts. 10,895
  8. Avatar for infjamc 28. infjamc Lv 1 43 pts. 10,886
  9. Avatar for Sandrix72 29. Sandrix72 Lv 1 42 pts. 10,879
  10. Avatar for fiendish_ghoul 30. fiendish_ghoul Lv 1 40 pts. 10,875

Comments