2110: Revisiting Puzzle 114: Black Mamba
Closed since about 4 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- February 17, 2022
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
Sequence:
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK
Top groups
Comments