Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 2 pts. 9,396
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,092
  3. Avatar for BITS_215_22 13. BITS_215_22 1 pt. 8,705
  4. Avatar for BPS_2025 14. BPS_2025 1 pt. 8,522
  5. Avatar for Window Group 15. Window Group 1 pt. 7,774
  6. Avatar for BIOB101 - Discover Biology 16. BIOB101 - Discover Biology 1 pt. 6,352
  7. Avatar for test 2 17. test 2 1 pt. 6,348
  8. Avatar for Lakeland BIO353 18. Lakeland BIO353 1 pt. 6,348
  1. Avatar for heather-1 41. heather-1 Lv 1 27 pts. 10,607
  2. Avatar for Zosa 42. Zosa Lv 1 26 pts. 10,599
  3. Avatar for Oransche 43. Oransche Lv 1 25 pts. 10,463
  4. Avatar for Hellcat6 44. Hellcat6 Lv 1 24 pts. 10,309
  5. Avatar for AlkiP0Ps 45. AlkiP0Ps Lv 1 24 pts. 10,255
  6. Avatar for Blipperman 46. Blipperman Lv 1 23 pts. 10,253
  7. Avatar for dizzywings 47. dizzywings Lv 1 22 pts. 10,156
  8. Avatar for Merf 48. Merf Lv 1 21 pts. 10,136
  9. Avatar for Deleted player 49. Deleted player 20 pts. 10,082
  10. Avatar for cjddig 50. cjddig Lv 1 19 pts. 10,050

Comments